PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000135G0620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TCP
Protein Properties Length: 244aa    MW: 24018.4 Da    PI: 8.2652
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000135G0620genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP106.83.3e-3362118258
              TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58 
                      a+k+ +++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLlqqa+pa
  PH01000135G0620  62 APKRNSTKDRHTKVEGRGRRIRMPALCAARVFQLTRELGHKTDGETIEWLLQQAEPA 118
                      799*****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-2767118IPR005333Transcription factor, TCP
PROSITE profilePS5136925.47668122IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDVAGDAGGS RRPNFPLQLL EKKEEQPCSS SAAGSASGAG GNDNGSGAGG GGGGELQVRK  60
TAPKRNSTKD RHTKVEGRGR RIRMPALCAA RVFQLTRELG HKTDGETIEW LLQQAEPAGG  120
TPSGGGSGGG GGGIGESIWT FPQMGSAGAA AAVYRGSVPS GLHFMNFPAP MALLPGQQLG  180
LGPVVGSGAG GGEGHMGILA ALNAYRTQAA TDAAAGQGGG GGGSSQQQHG GGERHESMST  240
SDS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0993801e-173FP099380.1 Phyllostachys edulis cDNA clone: bphyst011g01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624016.13e-57PREDICTED: transcription factor TCP14
SwissprotQ9C9L22e-38TCP15_ARATH; Transcription factor TCP15
TrEMBLB8AIH11e-91B8AIH1_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA009049-PA3e-91(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37443479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.14e-35TCP family protein